Protein Info for AMB_RS11160 in Magnetospirillum magneticum AMB-1

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 739 PF13185: GAF_2" amino acids 77 to 221 (145 residues), 55.7 bits, see alignment E=2.7e-18 PF01590: GAF" amino acids 125 to 218 (94 residues), 36.5 bits, see alignment E=2.8e-12 TIGR00229: PAS domain S-box protein" amino acids 238 to 359 (122 residues), 52.1 bits, see alignment E=3.4e-18 PF13188: PAS_8" amino acids 242 to 302 (61 residues), 30.5 bits, see alignment 1e-10 PF00989: PAS" amino acids 243 to 348 (106 residues), 35.6 bits, see alignment E=3.3e-12 PF13426: PAS_9" amino acids 252 to 351 (100 residues), 28.5 bits, see alignment E=6.2e-10 PF00512: HisKA" amino acids 368 to 436 (69 residues), 39.6 bits, see alignment E=1.7e-13 PF02518: HATPase_c" amino acids 481 to 594 (114 residues), 74.1 bits, see alignment E=5.1e-24 PF00072: Response_reg" amino acids 621 to 729 (109 residues), 68.1 bits, see alignment E=2.9e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2205)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W566 at UniProt or InterPro

Protein Sequence (739 amino acids)

>AMB_RS11160 hybrid sensor histidine kinase/response regulator (Magnetospirillum magneticum AMB-1)
MAHGTLAEDEPAAKHGRAPGSRGGIIRLRRPGGTVSSLQSRERAAMSRDSDTNTGRRRID
QAANLLVRTTEALLQASDELELLEQICLIGIEAGHCLSWIGYAGRPPERQVTVMARAGQA
VGYLDDIAISWNNDAFGQGPTGTAIRTGQPYVVADTKTDPAFAPWRHKAELHGFRSGVAL
PLGEGEQKIGALMYYATQPQMFDAQVVGMLMGVARNLSHGITTLRMRARHQQVARELAES
EQRYRSLVELAPDAIVVHGHGSILFANQAAIHAFGASSRAPLTGKPVLDLVHPDSRGDAL
ERLETPPPGHILNHYRLLRLDGTPFEAEVLACSISFRGLPARLLVVRDISERTRVQETLM
QTAKLATLGEMAAGLVHELSQPLNIIRLASEGAMMLIERDKATQEFQTQQFALIAEQCER
TAEIIDDIRIFSRRDTTPVQVFDAALAVRSAIEVLEGQFRPDGISVDLDLPIGPLPVSGR
RIQLEQVTMNLLNNAHHALRDSKDAMPADWIGKIIVRANRQGDNVEIVIADNGPGIPDSM
KAHLFEPFFTTKEAGRGTGLGLSVSHGLVTAMKGGLILREGGEGATFVITLPLDLEAAGP
QPLPALSPGRTPAAVSADAHILVVDDEATAAETLARYLRELGYRVSIAGTGIEAWALFSE
DPADVVITDLRMPAGNGEQLVEKLRDFDPLLPIVIVTGHLGATERVAANLEDDRCAVLKK
PVALGQLGDLVTVFLQPPT