Protein Info for AMB_RS11115 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF13426: PAS_9" amino acids 21 to 112 (92 residues), 34.7 bits, see alignment E=3.6e-12 TIGR00229: PAS domain S-box protein" amino acids 24 to 113 (90 residues), 38.8 bits, see alignment E=4.8e-14 PF08448: PAS_4" amino acids 24 to 113 (90 residues), 29.1 bits, see alignment E=2e-10 PF00989: PAS" amino acids 25 to 113 (89 residues), 28.1 bits, see alignment E=3.4e-10 PF08447: PAS_3" amino acids 32 to 114 (83 residues), 46.2 bits, see alignment E=9.4e-16

Best Hits

KEGG orthology group: None (inferred from 68% identity to mag:amb3700)

Predicted SEED Role

"putative sensor (PAS) domain for methyl-accepting chemotaxis sensory transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>AMB_RS11115 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MAGDRKTPSGRERTFAHDELIVSKTDPKGRLTYVNDVFLTVSGYAESEVMGKPHSVIRHP
EMPRCVFKLLWDTIADGREIFAYVNNMAKNGDNYWVFAHVTPNFDSAGQIIGYHSNRRVP
EKAALETIKPLYCSLMEEERRHPDSKVGLERSWKMLNDAVATAGFDSYDRFIFTITPEN