Protein Info for AMB_RS11055 in Magnetospirillum magneticum AMB-1

Annotation: DUF3365 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details PF11845: DUF3365" amino acids 44 to 202 (159 residues), 67.5 bits, see alignment E=4.4e-22 PF13185: GAF_2" amino acids 275 to 421 (147 residues), 76 bits, see alignment E=8.7e-25 PF01590: GAF" amino acids 278 to 420 (143 residues), 38.7 bits, see alignment E=3.6e-13 PF00512: HisKA" amino acids 450 to 514 (65 residues), 40.6 bits, see alignment E=5.4e-14 PF02518: HATPase_c" amino acids 558 to 667 (110 residues), 96.8 bits, see alignment E=2.8e-31

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (670 amino acids)

>AMB_RS11055 DUF3365 domain-containing protein (Magnetospirillum magneticum AMB-1)
MTSNVRSSASISLSAFRKLILGASVLWTGAVVFSFWTGVQNEKRQAHNLAVHEARANVQT
DIGFRHWATSHGGVYVPPDERTPPNPYLNVPDRDVVTTSGQHLTLMNPAYMLRQLMQSGF
VAKGRITSMKPLNPDNAPDEWEVKALSRLGQGETEVAEDVQEDGKSALRLMLPMRIDEGC
LKCHGHQGYQVGDLRGGIDVTVALAPFEQGAAQEIRRLEINHGLIWLLVTCGIALTWMGG
KAHIRRQDEAEAKIAHLTDVYAALSHTNQCIIRCNTRQELFESIVKIAVDFGHFKMAWIG
IVDESTMEISPVAWAGDGFGYLDGLKISADPESPYGQGPSGRCIRSGEYCVTEDFAASNM
TTPWHQRAASFGFQASAAFPLSNQKKTVGTLTLYSNETDFFTPELIELLLEMAGDISFAL
DRMDLEASHQRQEAERQEMVDRLTASNTELERFAYVASHDLQEPLRSIVSFTQLVERQLG
DKLLPEEKTNFQFVVNSAKRMNLLIKDLLEFSRVTVKGNSFSNISLGDTCSAALENLKET
IQESGAEIVVGDLPEVMGDSVQIMQVFQNLIGNAIKFRHANRPSLITIDSEKQDGNWRIS
VSDNGIGIADTTQDIFEIFRRLHSGNQYPGSGVGLAICKRIVTRHGGRIWVESGIGSGAT
FRFTLPTVLD