Protein Info for AMB_RS11025 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR00229: PAS domain S-box protein" amino acids 16 to 129 (114 residues), 34.3 bits, see alignment E=1.2e-12 PF00989: PAS" amino acids 17 to 116 (100 residues), 27.2 bits, see alignment E=6.9e-10 PF08447: PAS_3" amino acids 33 to 115 (83 residues), 53.7 bits, see alignment E=4.2e-18 PF00512: HisKA" amino acids 143 to 209 (67 residues), 36.9 bits, see alignment E=6e-13 PF02518: HATPase_c" amino acids 253 to 364 (112 residues), 98.1 bits, see alignment E=8.6e-32

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>AMB_RS11025 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MIVANTGWPDLELLKAAPILIWRAGLDAKCNWFNPAWLAYTGRTMEQEMGNGWAEGVHPD
DFDRCLKIYLEAFALRQPFDMEYRIKRACGEYGWIVDYGIPIQNQSGEFLGYVGYCFDVS
VRRESEEKLGIACKDLAASNAELEQFAYVASHDLREPLRMIGSYVDLIERRYGHHFDADG
HEFIGFVRDGARRMDAMVLDLLAFSRIDRQGEPLVPMRIGDAISHAVKNLGAAIAECDAH
VVVDVDTSLMVVGDVYQLDRLFQNLIGNAIKYRKKGIRPHIAVAARLDDGKATFSVQDNG
IGIAPEYFDRIFLLFKRLHTREVYEGTGIGLSVCKKIVERHGGEIWVEQSPSGGSTFLFT
LPTPE