Protein Info for AMB_RS10960 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome c oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 73 to 99 (27 residues), see Phobius details amino acids 118 to 142 (25 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 198 to 224 (27 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 281 to 305 (25 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details amino acids 423 to 444 (22 residues), see Phobius details amino acids 464 to 487 (24 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 20 to 526 (507 residues), 724.5 bits, see alignment E=3.3e-222 PF00115: COX1" amino acids 28 to 474 (447 residues), 544.6 bits, see alignment E=9e-168

Best Hits

Swiss-Prot: 72% identical to COX1_BRADU: Cytochrome c oxidase subunit 1 (ctaD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to mag:amb2169)

MetaCyc: 70% identical to complex IV subunit 1 (Arabidopsis thaliana col)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5A2 at UniProt or InterPro

Protein Sequence (532 amino acids)

>AMB_RS10960 cytochrome c oxidase subunit I (Magnetospirillum magneticum AMB-1)
MSTAITHDHGHAQPHGWRRWLYSTNHKDIGTLYLIFSVIAGLLGGAMSIVIRMQLAHPGG
TIFNGDWHMYNVFVTAHALTMVFFTVMPALIGGFGNWFVPLMIGAPDMAFPRLNNISFWL
LPPAFIMMLLSMVEGAGAGTGWTLYPPLSTAYHPDASVDFAILGLHLAGISSVLGAINFV
CTILNMRAPGMTMHRMPLFVWAMLVTAFLLLLSIPVLAGALTMLLTDRNFGTTFFAPAGG
GDPLLYQHLFWFFGHPEVYIMILPAFGIISHIIATFSKKPVFGYLGMAYAMVAIGFVGFV
VWAHHMFTTGLAVDTRAYFTAATLVIAVPTGIKVFSWIATMWGGSITFRVPMMWAVGFVF
LFTMGGVTGVVLANNPVDVALHDTYYVVAHFHYVLSLGAVFAIFAGFYYWIGKMSGHQYP
ETLGKIHFWLTFVGVNIAFFPQHFLGAQGMPRRVPDYPDAFAGWNMVSSIGAYIAFAGTA
FFLVVVWRTFTAGKAVEANPWGSGATTLEWSVSSPPPLHSFDGLPHIGTPAE