Protein Info for AMB_RS10950 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome c oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details PF00510: COX3" amino acids 16 to 270 (255 residues), 294.3 bits, see alignment E=5.6e-92

Best Hits

Swiss-Prot: 53% identical to COX3_BRALA: Cytochrome c oxidase subunit 3 (COIII) from Branchiostoma lanceolatum

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to mag:amb2167)

MetaCyc: 52% identical to complex IV subunit 3 (Arabidopsis thaliana col)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5A4 at UniProt or InterPro

Protein Sequence (272 amino acids)

>AMB_RS10950 cytochrome c oxidase subunit 3 (Magnetospirillum magneticum AMB-1)
MSHAQATPRAPGNAPHPFHLVDPSPWPLVGSISALVLVYGAVSWFRDHAHTSVMLAGLGL
VAITMFGWWRDIFREARAGHAHTEAVCHGLRMGMSLFIASEVMFFVAFFWAYFHSALGIA
PMVSQWPPSGIQTLDTWHIPFINTLILMSSGVTLTKSHHALRHGHRGATKAWLAVTIALG
VLFLSLQIHEYGQALFAFTDGIYPSVFYMATGFHGFHVFVGVCFLTVCLNRVRVGDFTPA
KHVGFEAAAWYWHFVDVVWVFLFVWVYWWGNG