Protein Info for AMB_RS10870 in Magnetospirillum magneticum AMB-1

Annotation: KR domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF00106: adh_short" amino acids 8 to 186 (179 residues), 160.6 bits, see alignment E=6.7e-51 PF01370: Epimerase" amino acids 11 to 81 (71 residues), 21 bits, see alignment E=3.8e-08 PF08659: KR" amino acids 11 to 156 (146 residues), 40.7 bits, see alignment E=4.8e-14 PF13561: adh_short_C2" amino acids 17 to 232 (216 residues), 170.4 bits, see alignment E=9.9e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2150)

MetaCyc: 34% identical to 2-(S)-hydroxypropyl-CoM dehydrogenase subunit (Xanthobacter autotrophicus Py2)
2-(S)-hydroxypropyl-CoM dehydrogenase. [EC: 1.1.1.269]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.269

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5C1 at UniProt or InterPro

Protein Sequence (235 amino acids)

>AMB_RS10870 KR domain-containing protein (Magnetospirillum magneticum AMB-1)
MKWEFPGRVAVVTGGMRGIGRTIADGLLAGGAEVHVFDREAGELPQGMTAHAVDVSNSDS
VNAAFAAIGKPVHLLVNNAGITRDRTLLKMSDEEWGSVLTVNLTSAFNTIRAAGPGMVQA
GVGRIVNMISINGLRGKMGQGNYAASKAGMVGLTKTAAKELGSKGVTCNAVAPGMVLTEM
TLKLDQQFRDKALAEAALSILPDTTDIANAVLFLLSDAARCITGEVIKVDSGQYI