Protein Info for AMB_RS10830 in Magnetospirillum magneticum AMB-1

Annotation: 6-oxocyclohex-1-ene-1-carbonyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03200: 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase
  • amino acids 17 to 372 (356 residues), 726.1 bits, E=3.7e-223
• PF16113: ECH_2
  • amino acids 53 to 304 (252 residues), 73.8 bits, E=1.9e-24
• PF00378: ECH_1
  • amino acids 53 to 232 (180 residues), 120.7 bits, E=6.8e-39

Best Hits

Swiss-Prot: 80% identical to BAMA_THAAR: 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase (oah) from Thauera aromatica

KEGG orthology group: K07539, 6-oxo-cyclohex-1-ene-carbonyl-CoA hydrolase [EC: 3.7.1.-] (inferred from 100% identity to mag:amb2143)

MetaCyc: 52% identical to 6-oxocyclohex-1-ene-1-carbonyl-CoA hydratase monomer (Syntrophus aciditrophicus)
OAHTHAUERA-RXN [EC: 3.7.1.21]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (27/35 steps found)
• adipate degradation (5/5 steps found)
• benzoyl-CoA degradation I (aerobic) (6/7 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• pyruvate fermentation to butanoate (5/7 steps found)
• L-isoleucine degradation I (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• phenylacetate degradation I (aerobic) (6/9 steps found)
• valproate β-oxidation (6/9 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• fatty acid β-oxidation I (generic) (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• glycerol degradation to butanol (10/16 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (2/5 steps found)
• L-valine degradation I (4/8 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• benzoyl-CoA degradation II (anaerobic) (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• L-glutamate degradation VII (to butanoate) (6/12 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (4/10 steps found)
• gallate degradation III (anaerobic) (3/11 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (7/17 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (5/16 steps found)
• toluene degradation VI (anaerobic) (6/18 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• L-tryptophan degradation III (eukaryotic) (3/15 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (11/27 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Biphenyl degradation
• Butanoate metabolism
• Caprolactam degradation
• Ethylbenzene degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Lysine degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 3.7.1.- or 3.7.1.21 or 4.2.1.17

Sequence Analysis Tools

See Q2W5C8 at UniProt or InterPro

Protein Sequence (377 amino acids)

>AMB_RS10830 6-oxocyclohex-1-ene-1-carbonyl-CoA hydratase (Magnetospirillum magneticum AMB-1)
MKKETAAIVDSTAPAHLNDHNLVPTTVVPGVLYEKRPAKRADGTVAEGLYNAWITLDNQK
QYNSYTTDMVKGVIMAFRDASNARDVSSVVFTGAGDKAFCTGGNTKEYAEYYAGNPQEYR
QYMRLFNDMVSAILGCDKPVICRVNGMRIGGGQEIGMAADFSVAQDLAKFGQAGPKHGSA
PIGGATDFLPVMIGCEQAMVSGSLCEPWSAHKAYRTGIIMDLVPALKVDGKFVANPLVIT
DRYLDEFGKIVHGESKTGAELAAGKELLKKGTIDLSLLDAKVEEICAKILHTFPDCFTKT
IQELRKPKLNAWNANKENSRDWLGLNMMTEARTGFRAFNEGPKEDREIDFVALRQALAKG
APWTPELIESLIPKAGH