Protein Info for AMB_RS10805 in Magnetospirillum magneticum AMB-1

Annotation: benzoyl-CoA reductase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR00241: putative CoA-substrate-specific enzyme activase" amino acids 5 to 263 (259 residues), 152.7 bits, see alignment E=1.3e-48 TIGR02261: benzoyl-CoA reductase, subunit D" amino acids 5 to 265 (261 residues), 465.7 bits, see alignment E=3.6e-144 PF01869: BcrAD_BadFG" amino acids 8 to 265 (258 residues), 232.8 bits, see alignment E=2.8e-73

Best Hits

Swiss-Prot: 74% identical to BCRD_THAAR: Benzoyl-CoA reductase subunit D (bcrD) from Thauera aromatica

KEGG orthology group: K04115, benzoyl-CoA reductase subunit [EC: 1.3.7.8] (inferred from 100% identity to mag:amb2138)

MetaCyc: 74% identical to benzoyl-CoA reductase delta subunit (Thauera aromatica)
1.3.99.15-RXN [EC: 1.3.7.8]

Predicted SEED Role

"Benzoyl-CoA reductase subunit BadG (EC 1.3.99.15)" (EC 1.3.99.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.7.8, 1.3.99.15

Use Curated BLAST to search for 1.3.7.8 or 1.3.99.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5D3 at UniProt or InterPro

Protein Sequence (279 amino acids)

>AMB_RS10805 benzoyl-CoA reductase subunit D (Magnetospirillum magneticum AMB-1)
MSELITTGVDIGSGCIKTVVFKVNGDKVEWLGKETARIRNRDPFQLTNEAYDHMLKTAGV
DRKDVAYVASTGDAENLSFATGHFYSMTTHGRGGLYLNPEARAVLDIGALNGRAIRMDGV
GKVLSYKMTSQCASGSGQFLENIARYLGIAQDEIGSLSMKADDPEKVSSICAVLAETDVI
NMVSRGISASNILKGIHVSMAVRLAKLLKSIGAVDGIVQVTGGLALDTGLVAALNEAAEQ
EKVNLKAVSHPDSIYAGAIGAALWGAFRHEKLARLGQAA