Protein Info for AMB_RS10795 in Magnetospirillum magneticum AMB-1

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13432: TPR_16" amino acids 18 to 73 (56 residues), 17.1 bits, see alignment 5.6e-06 amino acids 80 to 142 (63 residues), 37.3 bits, see alignment E=2.7e-12 amino acids 149 to 211 (63 residues), 40.4 bits, see alignment E=2.9e-13 amino acids 215 to 263 (49 residues), 23.5 bits, see alignment 5.7e-08 PF07721: TPR_4" amino acids 42 to 65 (24 residues), 12 bits, see alignment (E = 0.00026) amino acids 109 to 134 (26 residues), 22.3 bits, see alignment (E = 1.3e-07) amino acids 148 to 168 (21 residues), 11.3 bits, see alignment (E = 0.00044) amino acids 179 to 202 (24 residues), 11.1 bits, see alignment (E = 0.00052) PF14559: TPR_19" amino acids 52 to 95 (44 residues), 27.1 bits, see alignment 3.8e-09 amino acids 86 to 149 (64 residues), 28.8 bits, see alignment E=1.1e-09 amino acids 155 to 214 (60 residues), 42.9 bits, see alignment 4.5e-14 PF13181: TPR_8" amino acids 112 to 141 (30 residues), 18.2 bits, see alignment (E = 2e-06) amino acids 146 to 175 (30 residues), 23.6 bits, see alignment (E = 3.5e-08) amino acids 179 to 210 (32 residues), 18.5 bits, see alignment (E = 1.5e-06) PF13174: TPR_6" amino acids 113 to 140 (28 residues), 12.5 bits, see alignment (E = 0.00018) PF13428: TPR_14" amino acids 143 to 184 (42 residues), 24.5 bits, see alignment 2.5e-08 PF07719: TPR_2" amino acids 145 to 176 (32 residues), 28.2 bits, see alignment (E = 1.2e-09) PF13424: TPR_12" amino acids 145 to 207 (63 residues), 41.6 bits, see alignment E=1e-13 PF13176: TPR_7" amino acids 148 to 174 (27 residues), 16.4 bits, see alignment (E = 6.7e-06) amino acids 179 to 212 (34 residues), 20.4 bits, see alignment (E = 3.6e-07) PF13414: TPR_11" amino acids 150 to 190 (41 residues), 39 bits, see alignment 4.6e-13 PF13431: TPR_17" amino acids 165 to 197 (33 residues), 27 bits, see alignment (E = 3.1e-09) PF13374: TPR_10" amino acids 178 to 206 (29 residues), 20 bits, see alignment (E = 4.9e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2136)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5D5 at UniProt or InterPro

Protein Sequence (548 amino acids)

>AMB_RS10795 tetratricopeptide repeat protein (Magnetospirillum magneticum AMB-1)
MNNAVLLQSMFQRAVQAFNGGNLEMAAAECERMLGIDRRNTAAMHILGSVAFRRGDPAGA
ADLLAKVVKQDPGRIQAVITLGEAQLALSRFSDAAANFRKVAAARPDDPVPHYNLGLALR
GLGRLDEAAAVLERCRDMDPSVPAPWNVLGDIRRAQGRLDEAVTCLERAIQLDPGHSMAY
NNLGVALQAQDRTEEAISVLERGLALQPDDPELHYSLGCSLQEATRTADATASYRRAIAL
RPDYGAAHWNLSHSLLRGGDFSEGWAEYDWRWQTVQTADRHPQPLWTGDPADGRTILLWE
EQGLGDTLQFIRFAPQLAAAGWKVVAVVQKPLKLLLSNLAGVEVLARGEALPPFDVHCPL
MGLPGRLGSTPETIPSRPYLAAEPGKVAAWRERLVSQGLRVGVVWRGNPDNKRNPYRSMP
SPLLAGLLNRPDVQLVNLQKDAQRDELDAMGAGARLFDATSDLTDFSDTAALVASLDLVV
TVCTSVCHLAGGLGVPTWVLLDARADWRWFEGRLDSPWYPSARLFRQPSPGDWASVMAQV
SEALPGFK