Protein Info for AMB_RS10665 in Magnetospirillum magneticum AMB-1

Annotation: phosphoribosylformylglycinamidine synthase subunit PurQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01737: phosphoribosylformylglycinamidine synthase I
  • amino acids 1 to 227 (227 residues), 326.1 bits, E=4.9e-102
• PF13507: GATase_5
  • amino acids 2 to 209 (208 residues), 136.9 bits, E=1.1e-43
• PF07685: GATase_3
  • amino acids 33 to 95 (63 residues), 33.4 bits, E=5.4e-12
• PF01965: DJ-1_PfpI
  • amino acids 36 to 100 (65 residues), 33.5 bits, E=5.5e-12

Best Hits

Swiss-Prot: 59% identical to PURQ_RHOPB: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Rhodopseudomonas palustris (strain BisB18)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 100% identity to mag:amb2114)

MetaCyc: 48% identical to phosphoribosylformylglycinamidine synthetase subunit I (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Sequence Analysis Tools

See Q2W5F7 at UniProt or InterPro

Protein Sequence (229 amino acids)

>AMB_RS10665 phosphoribosylformylglycinamidine synthase subunit PurQ (Magnetospirillum magneticum AMB-1)
MKAAVIVFPGSNCDRDVAVALESSMGSKPLMVWHRDTQLPDLDLIVVPGGFSYGDYLRCG
AMAAHSPIMHEVKRQAEKGTRVLGICNGFQILTETGLLPGVLMRNRNLKFICKDVYLRVE
NAGTDFTRKHKLGDVVRYPIAHAEGNYFAEPETFRAMEGNGQVAFRYCSKHGEVSDAVNP
NGALSNVAGIYNEAKTVLGLMPHPERLAEDLLGGSDGKKMFDSLVEALR