Protein Info for AMB_RS10555 in Magnetospirillum magneticum AMB-1

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 TIGR00416: DNA repair protein RadA" amino acids 1 to 429 (429 residues), 572.2 bits, see alignment E=3.8e-176 PF18073: Zn_ribbon_LapB" amino acids 9 to 36 (28 residues), 41.5 bits, see alignment (E = 2.6e-14) PF06745: ATPase" amino acids 72 to 139 (68 residues), 30.7 bits, see alignment E=6.3e-11 PF13481: AAA_25" amino acids 77 to 219 (143 residues), 56.3 bits, see alignment E=1e-18 PF13541: ChlI" amino acids 343 to 425 (83 residues), 33.6 bits, see alignment E=1e-11 PF05362: Lon_C" amino acids 363 to 453 (91 residues), 24.9 bits, see alignment E=4.1e-09

Best Hits

Swiss-Prot: 61% identical to RADA_BRUA2: DNA repair protein RadA (radA) from Brucella abortus (strain 2308)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 100% identity to mag:amb2091)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5I0 at UniProt or InterPro

Protein Sequence (460 amino acids)

>AMB_RS10555 DNA repair protein RadA (Magnetospirillum magneticum AMB-1)
MAKSPSSQFVCQECGAVTRKWAGKCEACGAWNSITEEAAREEVPKGLTAGKGKRIEFVGL
EGSAAPLARWLTGIGELDRVCGGGLVPGSCLLVGGDPGIGKSTLLLQATARLSSQISVAY
ISGEEAVDQVRMRAARLGYAKATVALASAGSLRDIIASLDQPDAPQVVVIDSIQTVYADN
IESAPGTVSQVRACAAELIRLAKRRGFVLFLVGHVTKEGTIAGPRVLEHMVDTVLYFEGD
RGHQFRILRAVKNRFGATDEIGVFEMTEGGLSEVANPSALFLAERRGNVSGSCVFAGMEG
TRPMLVEIQALVAPSSLSSPRRAVVGWDTNRLSMVLAVLDARCGLALSGNDVYLNVAGGL
RIAEPAADLAVAAALVSSASDVPVPADMVVFGEIGLSGEVRAVAQADTRLKEAAKLGFAQ
ALVPARPRKDKGGGAAGAGSPLAIRSIGHLQDVLGLFRHE