Protein Info for AMB_RS10245 in Magnetospirillum magneticum AMB-1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 225 to 251 (27 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 277 (268 residues), 134.9 bits, see alignment E=1.5e-43

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to mag:amb2029)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5P2 at UniProt or InterPro

Protein Sequence (289 amino acids)

>AMB_RS10245 branched-chain amino acid ABC transporter permease (Magnetospirillum magneticum AMB-1)
MDATFFVNVISAGLLTGLVYGLMALGLSVIFGVMRVVNFAHGDMMVVAMYAAFLLFTKLG
IEPVPALPLVAGGLFVVGYLLQRFLINHFLGVTEHIQFLLLLSVAMIITNVVLMVFGPDA
RNIQLDASFESYNLGWLVLDKVRVIAAFTAGGVAALLWAFFRYTTTGTAIRACADNPVGA
RVVGLDVEKLYAITFGIGTACVGAAGCLLLLLVDVHPHLSSDYTLLGFIIVILGGLGSLG
GALLGGILVGLSEALSGVLIAPSLKSMFSFGLLILVLLLRPQGILGKKP