Protein Info for AMB_RS10205 in Magnetospirillum magneticum AMB-1

Annotation: 4-hydroxybenzoyl-CoA reductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR03195: 4-hydroxybenzoyl-CoA reductase, beta subunit" amino acids 3 to 322 (320 residues), 564.1 bits, see alignment E=4.3e-174 PF00941: FAD_binding_5" amino acids 6 to 214 (209 residues), 117.6 bits, see alignment E=5.4e-38 PF03450: CO_deh_flav_C" amino acids 221 to 316 (96 residues), 36.1 bits, see alignment E=6e-13

Best Hits

Swiss-Prot: 73% identical to HCRB_THAAR: 4-hydroxybenzoyl-CoA reductase subunit beta (hcrB) from Thauera aromatica

KEGG orthology group: K04109, 4-hydroxybenzoyl-CoA reductase subunit beta [EC: 1.3.7.9] (inferred from 100% identity to mag:amb2021)

MetaCyc: 73% identical to 4-hydroxybenzoyl-CoA reductase beta subunit (Thauera aromatica)
OHBENZCOARED-RXN [EC: 1.1.7.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.7.9

Use Curated BLAST to search for 1.1.7.1 or 1.3.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5Q0 at UniProt or InterPro

Protein Sequence (324 amino acids)

>AMB_RS10205 4-hydroxybenzoyl-CoA reductase subunit beta (Magnetospirillum magneticum AMB-1)
MNILPDFRTLRPASLSDAVAALAVPGAEPLAGGTDLLPNLRRGLGKPETLVDLTGITGFA
AISVGADGTLRIGAGATLEAVAEDARVLASWPVLAQAASLVAGPSHRAAATLGGNLCQDT
RCVFYNQSEWWRSGNGFCLKYEGDKCHVVVKSDRCYATYHGDVAPALMVLNASAEVVGPK
GVRLVPVADLFVESGAAHLSLDHGEVLAALLVPPATGWTAAYSKVRVRDAIDFPLAGVAV
ALKRDGNAIAGLRVAMTGTNSAPLMVPTDALWGRPWNDETAEALVQAVRKVSNVLKTTVA
GVKYRRRVLLAVARRQMDYLWNGK