Protein Info for AMB_RS10130 in Magnetospirillum magneticum AMB-1

Annotation: sulfate ABC transporter permease subunit CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 67 to 94 (28 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 252 to 275 (24 residues), see Phobius details TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 18 to 280 (263 residues), 402.6 bits, see alignment E=8.4e-125 TIGR00969: sulfate ABC transporter, permease protein" amino acids 22 to 277 (256 residues), 314.4 bits, see alignment E=6.9e-98 PF00528: BPD_transp_1" amino acids 85 to 278 (194 residues), 74.7 bits, see alignment E=4e-25

Best Hits

Swiss-Prot: 53% identical to CYST_NEPOL: Probable sulfate transport system permease protein cysT (cysT) from Nephroselmis olivacea

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 100% identity to mag:amb2010)

MetaCyc: 49% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5R1 at UniProt or InterPro

Protein Sequence (285 amino acids)

>AMB_RS10130 sulfate ABC transporter permease subunit CysT (Magnetospirillum magneticum AMB-1)
MGAVAAFALSLPRRVPSVIPGFGPTMGLTLAYLSLIVLLPLAALVIKAAGTTWSQWGAIV
TDARVLSALGLSFGAALVAALINAVFGLLVAWVLVRYPFPGRRLVDAVVDLPFALPTAVA
GIALTALYAPNGWIGSVLEPLGVKVAFTPLGVVVAMVFIGLPFVVRTVEPVLHDVDLELE
EAAASLGADRLQTFLKVILPSILPSLLTGFSLSLASAVGEYGSVIFIAGNLPGVSEIAPL
LIVTKLEQYDYVGATAIATLMLAISFTLLLVVNLLQKWRRGRMGG