Protein Info for AMB_RS09950 in Magnetospirillum magneticum AMB-1

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 820 TIGR00229: PAS domain S-box protein" amino acids 32 to 148 (117 residues), 65.9 bits, see alignment E=3.8e-22 amino acids 151 to 266 (116 residues), 57.9 bits, see alignment E=1.2e-19 amino acids 267 to 389 (123 residues), 60.4 bits, see alignment E=1.9e-20 PF00989: PAS" amino acids 33 to 139 (107 residues), 48.4 bits, see alignment E=3e-16 amino acids 271 to 379 (109 residues), 42.5 bits, see alignment E=2.2e-14 PF08448: PAS_4" amino acids 36 to 141 (106 residues), 34.6 bits, see alignment E=6.7e-12 amino acids 275 to 383 (109 residues), 39.7 bits, see alignment E=1.7e-13 PF13426: PAS_9" amino acids 45 to 141 (97 residues), 49.5 bits, see alignment E=1.6e-16 amino acids 166 to 260 (95 residues), 44.2 bits, see alignment E=7.1e-15 amino acids 279 to 380 (102 residues), 32 bits, see alignment E=4.6e-11 PF08447: PAS_3" amino acids 52 to 135 (84 residues), 32.8 bits, see alignment E=2.4e-11 PF13188: PAS_8" amino acids 155 to 206 (52 residues), 25.3 bits, see alignment 3.8e-09 amino acids 270 to 316 (47 residues), 22.8 bits, see alignment 2.4e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 389 to 552 (164 residues), 135 bits, see alignment E=2.1e-43 PF00990: GGDEF" amino acids 393 to 550 (158 residues), 154.4 bits, see alignment E=8.1e-49 PF00563: EAL" amino acids 571 to 805 (235 residues), 240.1 bits, see alignment E=7.7e-75

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1971)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5V0 at UniProt or InterPro

Protein Sequence (820 amino acids)

>AMB_RS09950 GGDEF domain-containing protein (Magnetospirillum magneticum AMB-1)
MSQAPEAAGERIPAGLHAAEAAGERIPAGLHAALLRDLPDVLYSVDAAGRFIWVSPNAAT
VFGYSAEELVGMEAAALYAKPEDRVGTVRRIRDAGGRAVRSEVEMRRKDGISIWAAIYAC
ALMDGEGRITGINGAIRDITEIWQTRKTLGDSEDRFRRLSDVATEAICIHFQGKIIDMNK
AFETLFAYSRDELLTMWAWDVIDPRDISLAKSMVAQQYEAPYEVRGIRKDGSVFPMEIHS
KHSRMGGDSVRVTSIRDLTQSKKAEASVRLLSQAVEQSPVAVAVVGGDGMVQYVNSAHAS
LTGHSSSAVVGKPLSALYPGKAGAMLGDFWRTLLGQGELQGELQVNRQDGTWQWQQVHGS
KVATPGEEGTHYLLQIEDVTLRKDQERRLQHQALFDGLTDLPNRVHALDRLAREIDMARD
HGRKVGLLFVDLDGFKAINDSLGHEYGDELLVLAAERLRQAAGDGGVVARFGGDEFLVIM
GDMEDGAAAGEVAAAIVDRFSQPFTISRRDLISTASIGLALYPEDGRTQQTLLRNADIAM
YQAKLAGRNRFCFFTSRMNEEAEARLRMEGELRRAVGTDQFHLVYQPLVAVATGRAVGVE
ALLRWSNPELGNVPPDRFIPQAETCGVIVAIGRMVLETACRDARRWVEDGHADLRLCINV
SPRQFQDAGFLGDVRAALAGSGLSPANLELEITEGLLLTERGDVDTLLRTLTDMGVKLSI
DDFGTGYSSLSYLERFPFDTLKIDRSFMIGMLERQERKVLVETIVAMASGLGLEVIAEGV
ETAEQMAHLAAINCDIAQGYLFSRPVPAGDISPLLDRVFR