Protein Info for AMB_RS09925 in Magnetospirillum magneticum AMB-1

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 72.5 bits, see alignment E=4.8e-24 amino acids 144 to 257 (114 residues), 88.1 bits, see alignment E=7e-29 PF00512: HisKA" amino acids 334 to 415 (82 residues), 27.7 bits, see alignment E=3.6e-10 PF02518: HATPase_c" amino acids 459 to 561 (103 residues), 92.3 bits, see alignment E=4e-30

Best Hits

KEGG orthology group: K02482, two-component system, NtrC family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to mag:amb1967)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5V4 at UniProt or InterPro

Protein Sequence (566 amino acids)

>AMB_RS09925 hybrid sensor histidine kinase/response regulator (Magnetospirillum magneticum AMB-1)
MNDDHLILIVEDSVTQALKLQLVMEQEGFQTVCAHSGEEALEQINRCRPSLIIVDYHLPG
IQGDELCRQIHMDITTRSIPLMMLTADETSAAELHGLESGADDFVAKSEDPEILLLRVHN
LLRKARREAVNVEVGRSLFRRARVLIIDDSMTYRESLAQELTDEGCDVTQVTSGVDGLRL
LAESDFDCVMVDMVMPGMDGIAVCKELSKLRSDNDAPLVVLMLSAYEHKENVARALEAGA
DDFVGKSTEMSLLRARLRALLRRKFLLEQNQRIVEEIRLREMETLRAKAEKEAAEARAAL
AEGLARANRELEEANAKLRETQVHLIQSEKMASLGQLVAGIAHEINNPLSFALSNVFSIE
NWLAAVMTEAAPCLSEDHLVKLDKARKRIADTGQGLERVRELVVKLRTFSRLDEGEFKTV
DIKEAVESVLLFLRHKMSDRIEVRRNFAEDNMLACYAGQLNQVIMNVVANAVDAIEGKGV
ITVRTFRQDGMFAIAVSDTGSGIPPEIQERIFDPFFTTKPVGQGTGLGLSISYGIIKSHD
GRIEVSSHPGQGTEIRILIPINLVGT