Protein Info for AMB_RS09810 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details PF03458: Gly_transporter" amino acids 11 to 83 (73 residues), 64.4 bits, see alignment E=3.5e-22 amino acids 96 to 169 (74 residues), 71.8 bits, see alignment E=1.7e-24

Best Hits

Swiss-Prot: 39% identical to Y4104_STRCO: UPF0126 membrane protein SCO4104 (SCO4104) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: None (inferred from 100% identity to mag:amb1944)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5X7 at UniProt or InterPro

Protein Sequence (218 amino acids)

>AMB_RS09810 hypothetical protein (Magnetospirillum magneticum AMB-1)
MLIGQFTLPLAFDLAATFLFALTGALTAMRKGYDFVGVFFLALVTGIGGGLLRDGLFLQQ
VPAVLGSHYLLAVVVATVIGLVFGQSLNRLALVFLLVDALGLGLYTVFGAQKALNAGLGW
IPALLIGVINAVGGGVLRDLMSREDPLIFRPGEFYAAASLAGGMVFAVLALGMGLAAQLA
ALAGIGVTVLVRVASVRFGWRTPAARALIGRDQPPGEA