Protein Info for AMB_RS09640 in Magnetospirillum magneticum AMB-1

Annotation: potassium-transporting ATPase A chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details amino acids 477 to 504 (28 residues), see Phobius details amino acids 517 to 539 (23 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 550 (550 residues), 719.5 bits, see alignment E=1.4e-220 PF03814: KdpA" amino acids 11 to 548 (538 residues), 772.4 bits, see alignment E=1e-236

Best Hits

Swiss-Prot: 100% identical to KDPA_MAGSA: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to mag:amb1909)

MetaCyc: 56% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W612 at UniProt or InterPro

Protein Sequence (556 amino acids)

>AMB_RS09640 potassium-transporting ATPase A chain (Magnetospirillum magneticum AMB-1)
MDAHGVLQFLLFLALVLALTPILGRFMTWLFQAPVGRVEDGFYRLLGIDPTREQGWAAYA
VSLLIFHLLAVFGLYALQRFQGMLPLNPAGQGAVPPDLAFNTAISFATNTNWQNYGGEST
MSHLTQMAGLTVHNFLSAAAGIAVAVALMRGFARHSTRTVGNFYVDITRVTLGLLLPLCL
VGALVLVGQGVPQNFDAPVTVTTLEGVSQVIAQGPVASQMMIKHLGTNGGGFFNANAAHP
YENPNALVNLIHMLAIFAIGAALTNTFGRMAGDRRQGWALLGAMAALFLAGLGAAWWAEA
QGNPVLGGIANMEGKEVRLGVAASMLFAVVTTVTSCGAVNAMHDSLLPLAGMIPMVNMLL
GEVVVGGVGSGLYGMVVFALLTVFIAGLMVGRTPEYLGKKIEAREIKLAVIAILATPVAV
LGIGGLAITLPMGQAGIAAAGPHGLSEVLYAFASAGNNNGSAFGGLSGNTIFYNATMAAA
MMIGRFVVMIPVLAIAGALAAKMAVPASAGTFPTHGWLFVVLLVGIVLVVGGLTYFPVLV
LGPVVEHLALSAGILF