Protein Info for AMB_RS09400 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 201 to 231 (31 residues), see Phobius details amino acids 247 to 273 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 109 to 274 (166 residues), 84.3 bits, see alignment E=4.7e-28

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to mag:amb1859)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W662 at UniProt or InterPro

Protein Sequence (294 amino acids)

>AMB_RS09400 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MGMTKNFAPSLPLSGSLPPPARPGEGWGGGRLQLRSWALGITSLGLFLAAWHLATLYRLD
LHVRFGNVPSPEAVLRRALVAFADPRFLEHIAMSVQRIGAGFALAAIVAVPLGIAMGRFA
PLRSAVYPVVEVLRPIPAIAWVPMSIMLWPSNEESIVFITFLGSFFPILINTLHGVAAID
PALVRASRSLGAGEAALFRHVFLPGALPHIFTGLTVGMGVAWVSLIAAEMISGQFGIGYF
TWEAYALVQYADIVLGMLLIGVLGLASSGLIRLLGRAVMPWSTASAPLRREARP