Protein Info for AMB_RS09380 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 70 to 91 (22 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 249 (170 residues), 75.3 bits, see alignment E=2.6e-25

Best Hits

Swiss-Prot: 39% identical to Y4188_BRUSU: Probable ABC transporter permease protein BRA1188/BS1330_II1179 (BRA1188) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to mag:amb1855)

MetaCyc: 34% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W666 at UniProt or InterPro

Protein Sequence (256 amino acids)

>AMB_RS09380 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MSSAAIRRAARFSSALSGLGLLVAFWALAAAGLDNPVLLPSPAEVAGVLGEVIGSGAFHR
DLGASLRRVLGGYVLASGLAVPLALVMAAWGPLRQSLLPVVSLLRPIPPIAWIPLAILWF
GLGDAPSFFITAIAAFFPIFLNAFAGGLAVGGRYLDAARCLGATRLALLLEVRLPAALPM
IATGLRIGLGQSWMAVVTAELIAAQSGLGYMIQANRLTLQTAHVLVGMVTIGTLGALMTW
AFTLAERRLLVPWQEN