Protein Info for AMB_RS09290 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details transmembrane" amino acids 71 to 90 (20 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 329 to 354 (26 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details PF07690: MFS_1" amino acids 45 to 377 (333 residues), 98.5 bits, see alignment E=2e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1835)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W686 at UniProt or InterPro

Protein Sequence (424 amino acids)

>AMB_RS09290 MFS transporter (Magnetospirillum magneticum AMB-1)
MSLDPLEIPMPKLRTTLRRRRTMSPSRSGHSPLAILICASAILAISLGVRHSFGLFLQPV
TEAGGWSRESFGLAIALQNLVWGLSQPFAGMLADRIGAGRMIIAGTALYVVGLLVMALPQ
GETAFILGTGLLVGLGLSGTTYPLVLGAVTRATSPEKRSLALGLAMGGAAFGQFVMLPGA
LGGIGLLGWSGALMAMAVLTLAMAPLAVPLMETAHAPSQGAEMSAGQAIRLALGHRGFQL
LALGFFVCGFQVVFIATHVPAFLSDKGLTAGIGSTVLALIGLLNIPGTYYAGLWGAKWRK
PMLLSWLYVIRAVVIAAFAFLPVSEASAYAFGAAMGLVWLSTVPLTNGTVAALFGVRNMS
MLGGVVFLAHQLGAFLGGWLGGVLYDRLGSYDGAWIVAIGLSLLAALLNLPIREETAEPA
RAAA