Protein Info for AMB_RS09260 in Magnetospirillum magneticum AMB-1

Annotation: arsenical-resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 221 to 245 (25 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 285 to 313 (29 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 13 to 340 (328 residues), 380.8 bits, see alignment E=3e-118 PF13593: SBF_like" amino acids 23 to 325 (303 residues), 25.9 bits, see alignment E=6.1e-10 PF01758: SBF" amino acids 59 to 253 (195 residues), 104.4 bits, see alignment E=6.4e-34

Best Hits

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 100% identity to mag:amb1830)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W691 at UniProt or InterPro

Protein Sequence (352 amino acids)

>AMB_RS09260 arsenical-resistance protein (Magnetospirillum magneticum AMB-1)
MSIPCEVAAKPAMNLFERFLTLWVALCIVAGVALGHFLPGPFQAIGRLELAQVNLPVALL
IWLMIIPMLLKIDFGALHQVKEHWKGVGVTLFINWGVKPFSMALLGWIFVSHLFKPYLPA
DQIDSYIAGLILLAAAPCTAMVFVWSNLTNGEPHFTLSQVAVNDLIMVFAFAPIVGLLLG
LSSITVPWDTLLLSVMLYIVVPVIVAQAWRKALLARGLQALAATLATLGPLSLVALLTTL
VLLFGFQGEQIIAQPMVIAMLAVPITIQVYFNSGLAYWLNKRLGVAHCVAGPSALIGASN
FFELAVAAAISLFGFQSGAALATVVGVLIEVPVMLSVVKIVNASKGWYESKV