Protein Info for AMB_RS09135 in Magnetospirillum magneticum AMB-1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 198 to 223 (26 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 288 (281 residues), 162.8 bits, see alignment E=4.7e-52

Best Hits

Swiss-Prot: 54% identical to LIVH_ECOLI: High-affinity branched-chain amino acid transport system permease protein LivH (livH) from Escherichia coli (strain K12)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to mag:amb1805)

MetaCyc: 54% identical to branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6B6 at UniProt or InterPro

Protein Sequence (304 amino acids)

>AMB_RS09135 branched-chain amino acid ABC transporter permease (Magnetospirillum magneticum AMB-1)
MEYFLQQLINGLTLGAIYGLVALGYTMVYGVLGMINFAHGTIYMVGAFISLITFLVATTV
LGTSVPLALVLTLVAAMALTALWGWTAERVAYRPLRSAPRLAPLISAIGVSIMLQNFVAQ
AQGARAKPLPPVFRGGITLMDSGDFVVSLSWMQMVIMALTLALMAVFTWVITRTALGRAQ
RACEQDMKMASLLGIDVDRVISTTFVIGAGLAGVAGMMVTLYYGVIDFYIGFLAGIKAFT
AAVLGGIGSLPGAMLGGLLIGLIEAFWSAYFSIEYKDVATFSILVAVLVFRPTGLLGRPD
VEKI