Protein Info for AMB_RS09130 in Magnetospirillum magneticum AMB-1

Annotation: high-affinity branched-chain amino acid ABC transporter permease LivM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 115 to 147 (33 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 344 to 369 (26 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details PF11862: DUF3382" amino acids 11 to 97 (87 residues), 45.6 bits, see alignment E=7e-16 PF02653: BPD_transp_2" amino acids 109 to 393 (285 residues), 172.3 bits, see alignment E=1.2e-54

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to mag:amb1804)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6B7 at UniProt or InterPro

Protein Sequence (415 amino acids)

>AMB_RS09130 high-affinity branched-chain amino acid ABC transporter permease LivM (Magnetospirillum magneticum AMB-1)
MGGKTARALVVDALLGGVVAAAMALPMLGVRLEDGSTGLSLSGRLDWVAWAAGSVAGARL
LIGLLRLGLAGRGPSLPAPPRAMMVYVGWAMVAFALILPFLPFSGRNLVDKATLVLIYVM
LGWGLNIVVGLAGLLDLGFVAFYAVGAYSYALLSQTFGLSFWVCLPLAGLLAAAFGMVLG
FPVLRLRGDYIAIVTMGLGEIVRVVLQNWQDVTGGPNGISGIERPSLFGLSFKMVPPEGS
QTFAEFFGLDYSADHRVIFLYFLILALALLTNVITLRIRRLPVGRAWEALREDEIACRSL
GINPTLVKLSAFATGAMFAGFAGSFFATRQGFISPESFTFIESAVILAIVVLGGMGSQIG
IVLAALLLVGLPEWFRELQQFRMLAFGGAMVLIMLWKPAGLLSTREPTIRLGEAK