Protein Info for AMB_RS09110 in Magnetospirillum magneticum AMB-1

Annotation: diguanylate cyclase response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 PF00072: Response_reg" amino acids 186 to 285 (100 residues), 60.6 bits, see alignment E=1.6e-20 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 456 to 619 (164 residues), 150.3 bits, see alignment E=2e-48 PF00990: GGDEF" amino acids 458 to 617 (160 residues), 135.8 bits, see alignment E=1.2e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1800)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6C1 at UniProt or InterPro

Protein Sequence (622 amino acids)

>AMB_RS09110 diguanylate cyclase response regulator (Magnetospirillum magneticum AMB-1)
MAPDELHAAGSGAVESDAQAVGDGILVQARRAFVMEILGIDDDVGWHLGIGQLGLGQHVA
HHLVGHADDVLGLDADPFDRPDAAGIDIDAGAAFGVVHALAGGKGQSGGDDGSKGGQAAH
GEVLNLRLWRTDDRFIPNWGDDMAFPVVTHQASANLLRRLVSPERTRESPMRGGMDLALS
ETMFALLVEDSPTQALLTLAELEKLPNVKVDHAVSLASALEFIQRKRYHVIFLDLTLPDS
VGDETVRRFCGAAPELAVVVLTNHDDDQQALMALEQGAQDYLLKAKLDAASLSRSFRYAI
HRKRAEILVREARDAALEANRQLERRMRQIDCMYGVSRILESPELPLQVALEQVVAKVPT
AWLKPETIGVRLSCLPGLLPSGIVQTPVFMETAYRLESQVFAGSRPAGRIEICWSETPPA
EGDEAFSTAERELVRELARRIGLALERACVQKELVQLATTDFLTDACNRRHFMQSTVAEI
QRAGRYGRPLSLLMIDLDHFKRINDERGHAAGDEALKAFVVMARDLLRDQDIIGRMGGEE
FAIALPETALNPALVVAERLRIRLAGLQVPVGGGEPIILSASFGVAECRVGAGEGLEACL
GRADAALYRAKAMGRNRVEPAE