Protein Info for AMB_RS09075 in Magnetospirillum magneticum AMB-1
Annotation: N-acetyl-gamma-glutamyl-phosphate reductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to ARGC_ORYSJ: Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic (Os03g0617900) from Oryza sativa subsp. japonica
KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to mag:amb1793)Predicted SEED Role
"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)
MetaCyc Pathways
- L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
- L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
- L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
- L-ornithine biosynthesis I (5/5 steps found)
- superpathway of arginine and polyamine biosynthesis (11/17 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Geraniol degradation
- Limonene and pinene degradation
- Lysine biosynthesis
- Naphthalene and anthracene degradation
- Tryptophan metabolism
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 1.2.1.-
Use Curated BLAST to search for 1.2.1.- or 1.2.1.38
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W6C8 at UniProt or InterPro
Protein Sequence (346 amino acids)
>AMB_RS09075 N-acetyl-gamma-glutamyl-phosphate reductase (Magnetospirillum magneticum AMB-1) MKDVSIAILGASGYTGAELVRLLALHPTFKIKVMTGDRKAGQSMESVFPHLGGLELPTLV AIDQVDFTTVDAVFCCLPHGTTQEVIAALPASVKVVDLSADFRLFDVDTYAQWYGHEHRA PELQKQAVYGLTELARDAVAKARLVANPGCYPTSVQLPLIPLLKAGLIEAADIVIDAKSG VSGAGRAAKEANLYTEVTEGMHAYGVASHRHAPEIEQGLSAAAGVPVLVSFTPHLIPMSR GMLSTIYVKTKGGAKAADLRAQLSKTFGGEPFVRVVPEGVVPHTRHVRGSNHCLINVFDD RVPGKVIITSVIDNLVKGASGQALQNMNLMFGLPETTALAQQPMFP