Protein Info for AMB_RS09070 in Magnetospirillum magneticum AMB-1

Annotation: gamma carbonic anhydrase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF00132: Hexapep" amino acids 13 to 47 (35 residues), 28.1 bits, see alignment 5.9e-11 amino acids 92 to 125 (34 residues), 28.1 bits, see alignment 5.8e-11

Best Hits

Swiss-Prot: 43% identical to YTOA_BACSU: Uncharacterized transferase YtoA (ytoA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to mag:amb1792)

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6C9 at UniProt or InterPro

Protein Sequence (172 amino acids)

>AMB_RS09070 gamma carbonic anhydrase family protein (Magnetospirillum magneticum AMB-1)
MSGTILPFEGTSPTIAPDVFVAPTAVVIGDTVIGAGTSVWFNCVIRGDVHEIRIGERTNI
QDGTVIHVTGGKLGTYIGSDITIGHGAILHACTLEDACFVGMGAVVLDGVVVESGAMVAA
GAVVTPGKRVKAGELWGGNPAKLLRRLSDEEIAFFPVSAEKYVELAAKYFKA