Protein Info for AMB_RS08490 in Magnetospirillum magneticum AMB-1

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 6 to 298 (293 residues), 180.5 bits, see alignment E=1.1e-56 PF00070: Pyr_redox" amino acids 148 to 214 (67 residues), 53.8 bits, see alignment E=4.6e-18

Best Hits

Swiss-Prot: 50% identical to PADH_AZOEV: NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon (padH) from Azoarcus evansii

KEGG orthology group: None (inferred from 100% identity to mag:amb1679)

MetaCyc: 50% identical to phenylglyoxylate dehydrogenase (acylating) subunit PadH (Aromatoleum evansii)
Phenylglyoxylate dehydrogenase (acylating). [EC: 1.2.1.58]

Predicted SEED Role

"Nitrite reductase probable [NAD(P)H] subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.2.1.58 or 1.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6P2 at UniProt or InterPro

Protein Sequence (411 amino acids)

>AMB_RS08490 FAD-dependent oxidoreductase (Magnetospirillum magneticum AMB-1)
MMPEAKYLLVGSSHAALEALRAIRLVDPDGSMAMLTRDDRLPYSPTILPYVVSGRSAPDK
VLLRDPAFFAANNCAYVPNARAVSLDAKARAVTLENGEVWRYQSLLIASGAAPAIPPVKG
LDGVTYHVLRSLADAEGLRGAMGAAKTAVVLGAGLVGLHAAENMAEAGLKVTVVEMQGHV
LPGYFDAKASTRIEDAFTTHGVELKLGRKVVEVAPGKVMVDDGTTIAADLLLVATGVRPV
TDWLEGSGVLVDRGVVVDEAMRTNIDGVWAAGDVAQATDFASGNKALIGIIPTAVEQGKI
AGQGMAGDSYRKDYAGGLPVNTYRFFGRVALSIGRAAATDGVEAVETASGAYRRLVLEGN
RLVGYASVDEPFDVGIMGELIRRRVDLSECKDAFLARPVETGRRLMSEQWR