Protein Info for AMB_RS08460 in Magnetospirillum magneticum AMB-1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 38 to 70 (33 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details amino acids 282 to 305 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 36 to 292 (257 residues), 127.6 bits, see alignment E=2.5e-41

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to mag:amb1672)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6P9 at UniProt or InterPro

Protein Sequence (315 amino acids)

>AMB_RS08460 branched-chain amino acid ABC transporter permease (Magnetospirillum magneticum AMB-1)
MNLKTARTGGLAALAIVITLAPLGFSNSYFYDVGVNAMFNAILCVGLNLLIGYAGQISLG
HAGFFALGAYGSGILTERYGVPAIGALVLSASVVGILAFVVARPILKLKGHYLAMATLGI
GIIIHIVLKTEAGITGGPDGMSLGNFKMLGFTIKGDQMWYWVTGVLLVLAVWLSLNLIES
PVGRALRAVHGSEVGAEVVGVDTSSYKVLVFVVSAVFASVVGSLFAHKNGFITPDISSFF
HSVELVTMVVLGGMASIYGALIGAVILTLLPQVLAAVEQYEAMILGAIMMGTMIFMPKGL
LPSLLASLKRREAGK