Protein Info for AMB_RS08430 in Magnetospirillum magneticum AMB-1

Annotation: glutathione-disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 175 to 197 (23 residues), see Phobius details TIGR01424: glutathione-disulfide reductase" amino acids 4 to 446 (443 residues), 637.1 bits, see alignment E=6.4e-196 PF07992: Pyr_redox_2" amino acids 6 to 317 (312 residues), 236.9 bits, see alignment E=8.4e-74 PF13738: Pyr_redox_3" amino acids 120 to 301 (182 residues), 54.6 bits, see alignment E=2.7e-18 PF00070: Pyr_redox" amino acids 169 to 247 (79 residues), 81.2 bits, see alignment E=1.6e-26 PF01593: Amino_oxidase" amino acids 212 to 260 (49 residues), 22 bits, see alignment 2.4e-08 PF02852: Pyr_redox_dim" amino acids 337 to 445 (109 residues), 119.4 bits, see alignment E=2.2e-38

Best Hits

Swiss-Prot: 53% identical to GSHRP_ARATH: Glutathione reductase, chloroplastic (EMB2360) from Arabidopsis thaliana

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 100% identity to mag:amb1666)

MetaCyc: 42% identical to glutathione reductase (NADPH) (Escherichia coli K-12 substr. MG1655)
Glutathione-disulfide reductase. [EC: 1.8.1.7]

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6Q5 at UniProt or InterPro

Protein Sequence (455 amino acids)

>AMB_RS08430 glutathione-disulfide reductase (Magnetospirillum magneticum AMB-1)
MAAYDYDLITLGAGSGGVRASRMAAAAGRKVAVVESSRVGGTCVMRGCVPKKLLVYGAKF
AEDLTDSLGFGWSLEGADFDWARLVVAKNAELQRLEGVYLRLLKESGVTVVEGKGHLLDA
HTVQVGLRVLTAETILVATGGRPALPDVPGIEHAVTSNEALDLMQLPEKVVIVGGGYIAV
EFAGIFNALGVAVTLVLRGDTLLRGFDADIRATLAEEMTRKGVDLRTTTQVRAIRRHGHG
YGVELSDGQTLDADLVMYATGRVPNTEGLGLEKAGVVLNSKGAVMVDGLSRTSVRNIWAV
GDVTDRVNLTPVAIAEAMAFVRTAFSGQTTPMDYENIPSAVFSLPPVGTVGLTEAEATKR
YGAVDVYLSRFKPMRNILAGREERSMMKLVVDRATDRVLGVHMVGADAPEIVQGFAVALK
CGATKAQFDATVGIHPTAAEEFVTLRDKRAENGRA