Protein Info for AMB_RS08405 in Magnetospirillum magneticum AMB-1

Annotation: bile acid:sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 56 (23 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 295 to 318 (24 residues), see Phobius details PF13593: SBF_like" amino acids 11 to 322 (312 residues), 352.8 bits, see alignment E=1.8e-109 PF01758: SBF" amino acids 48 to 219 (172 residues), 58.4 bits, see alignment E=8e-20

Best Hits

Swiss-Prot: 42% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 100% identity to mag:amb1661)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6R0 at UniProt or InterPro

Protein Sequence (325 amino acids)

>AMB_RS08405 bile acid:sodium symporter (Magnetospirillum magneticum AMB-1)
MFKLLARVGIDGFLLGLIVMVGLAWLLPDFGKSGGYLAMDAITGYGVALVFLLYGLTLPP
ERMKAGLVNWRLHLLVQISTFGLFPVLAWGAALAFGGKIDPDLMLGFFFLAALPSTISSS
VAMTSIARGNVAGAIFNATLSSLLGVVLTPLWVNWYLSSSGASLDLGRVLLKIVLLVLLP
IILGQVLRPWVRGWIEHNTKWLKSLDRIIILLIVFNSFSDSVAEGVWAGHGGGFVAQAVG
GAAVLFAFVFILLRLTCRALGFNREDLIAGVFCGTKKSLATGVPMAKIMFGASPALGLII
APTILYHLIQLVAAGIIARRWQDEA