Protein Info for AMB_RS08370 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 42 to 48 (7 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 292 to 309 (18 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 347 to 370 (24 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 415 to 432 (18 residues), see Phobius details PF00083: Sugar_tr" amino acids 35 to 240 (206 residues), 96.5 bits, see alignment E=2.6e-31 amino acids 253 to 444 (192 residues), 40.1 bits, see alignment E=3.5e-14 PF07690: MFS_1" amino acids 37 to 386 (350 residues), 97.1 bits, see alignment E=1.5e-31 PF12832: MFS_1_like" amino acids 271 to 356 (86 residues), 26.3 bits, see alignment E=5.6e-10

Best Hits

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 100% identity to mag:amb1654)

Predicted SEED Role

"Alpha-ketoglutarate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6R7 at UniProt or InterPro

Protein Sequence (445 amino acids)

>AMB_RS08370 MFS transporter (Magnetospirillum magneticum AMB-1)
MDTTIAPAPVTPVTGSHDMESKDTKGKILMVFKGSVGNLVEYYDWYVYSAFSLYFSKYFF
PGDDPTVQLLNTSAIFALGFFMRPLGGWLLGTHADRKGRKAALLVSVSMMCAGSLIIAVM
PGYNSIGVAAPIALILARLLQGLSLGGEYGSAATYLSEIATKDRRGFYSSFQYVTLIMGQ
LLALGVLMALQRVFLTTAELEAWGWRIPFVIGGLCAIVAIYLRSSMEETESFEHHKGDRV
GESRIRALMRHPREVLTVIGLTMGGTVAFYTFTTYMQKYLVNTAGFSKSDATMISAAATF
VYMLMHPLVGHISDKVGRRAVLIAFGVMSTLCTVPILTALGQTHDSVTAFFLVLSGLTIV
SGYSAINAVVKAELFPVQIRALGVGLPFAIGVSLFGGTAEYIALWFKSMGNETWFYWYVT
GCCLCGLLLFVGMKDTKKTSLIDQD