Protein Info for AMB_RS08350 in Magnetospirillum magneticum AMB-1

Annotation: hydrogenase 2 small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 337 to 357 (21 residues), see Phobius details TIGR00391: hydrogenase (NiFe) small subunit (hydA)" amino acids 14 to 356 (343 residues), 465 bits, see alignment E=1.9e-143 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 17 to 39 (23 residues), 24.3 bits, see alignment (E = 3e-09) PF01058: Oxidored_q6" amino acids 63 to 208 (146 residues), 109.8 bits, see alignment E=7.9e-36 PF14720: NiFe_hyd_SSU_C" amino acids 228 to 306 (79 residues), 98.6 bits, see alignment E=2.2e-32

Best Hits

Swiss-Prot: 57% identical to MBHT_ECO57: Hydrogenase-2 small chain (hybO) from Escherichia coli O157:H7

KEGG orthology group: K06282, hydrogenase small subunit [EC: 1.12.99.6] (inferred from 100% identity to mag:amb1650)

MetaCyc: 57% identical to hydrogenase 2 small subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Uptake hydrogenase small subunit precursor (EC 1.12.99.6)" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase (EC 1.12.99.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.6

Use Curated BLAST to search for 1.12.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6S1 at UniProt or InterPro

Protein Sequence (376 amino acids)

>AMB_RS08350 hydrogenase 2 small subunit (Magnetospirillum magneticum AMB-1)
MYDDTEISREIANRFNLERRDFLKFCAAMAATMGLPKGAEAEIAQAITAKERPSVIWLHF
QECTGCTESMLRAEHPTIEKLILEIISLDYHETLFAAAGHQVEAAREAAMKKNWGKYVLV
IEGAIPVKDGGIYCKVGGKTALQLTKECAEGAAAVIAIGSCASWGGMPSTPPNPTGSTGV
PEILAPKPVVTIPGCPPNPYNFLSTVVHFLTFGSLPAVDDKGRPKFAYSRLIHENCERRA
HFDAGRFALEFGDEGHRKGYCLYKLGCKGPETYANCPAILFNDVGSGSWPVGTGHPCIGC
TEKGIGFHKPIHALAELQNQRPPVGYPRVVEEQGVGASIGAIATVAAVGGLAIGAGAKLV
GNLGKSENGQDSGKQG