Protein Info for AMB_RS08345 in Magnetospirillum magneticum AMB-1

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 297 to 316 (20 residues), see Phobius details PF12838: Fer4_7" amino acids 53 to 135 (83 residues), 31.3 bits, see alignment E=9.3e-11 amino acids 119 to 166 (48 residues), 28.5 bits, see alignment 7.1e-10 PF13237: Fer4_10" amino acids 116 to 163 (48 residues), 28.2 bits, see alignment 6e-10 PF13247: Fer4_11" amino acids 116 to 209 (94 residues), 75 bits, see alignment E=1.9e-24 PF12837: Fer4_6" amino acids 144 to 167 (24 residues), 31 bits, see alignment (E = 7e-11) PF12797: Fer4_2" amino acids 144 to 164 (21 residues), 25.8 bits, see alignment (E = 2.8e-09) PF00037: Fer4" amino acids 145 to 166 (22 residues), 28.1 bits, see alignment (E = 5.2e-10)

Best Hits

Swiss-Prot: 45% identical to HYBA_SHIFL: Hydrogenase-2 operon protein HybA (hybA) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to mag:amb1649)

MetaCyc: 45% identical to hydrogenase 2 iron-sulfur protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Fe-S-cluster-containing hydrogenase components 1" in subsystem Anaerobic respiratory reductases or Hydrogenases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6S2 at UniProt or InterPro

Protein Sequence (339 amino acids)

>AMB_RS08345 4Fe-4S dicluster domain-containing protein (Magnetospirillum magneticum AMB-1)
MTITRRNFLATAAAGGTAAAAACATLAPAGAEARESHKVPDNAVGLLYDATLCIGCKACM
SACKEANDLPLEDTIGEKLWDTPLELSGKTYNVIKVYQSGTMENKDKAENGFAHIKRSCL
HCADPSCVSACPVSAMQKRATDGVVTYNKDACIGCRYCVAACPFGVPQFQYDTPKPEIAK
CQLCKHRMEQGKYAACAESCPTGATIFGSYAALSAEIDRRRAMKPGEPNLFPRRTPESGD
MHEKAAPEYVDYVYGQKDAGGTQVRYLSGVAFDKLALPMGLPERAYAADSETLQHTLYGG
MILPVVALAGLVTAAWRGSKDHHDDDEFDMFDHPEGGHK