Protein Info for AMB_RS08200 in Magnetospirillum magneticum AMB-1

Annotation: aminoacetone oxidase family FAD-binding enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 375 to 392 (18 residues), see Phobius details PF03486: HI0933_like" amino acids 2 to 389 (388 residues), 361.2 bits, see alignment E=1e-111 TIGR00275: flavoprotein, HI0933 family" amino acids 4 to 388 (385 residues), 300.7 bits, see alignment E=1.5e-93 PF13450: NAD_binding_8" amino acids 5 to 36 (32 residues), 24.4 bits, see alignment (E = 4.3e-09) TIGR03862: flavoprotein, TIGR03862 family" amino acids 23 to 393 (371 residues), 501.9 bits, see alignment E=9.7e-155

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 100% identity to mag:amb1623)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6U8 at UniProt or InterPro

Protein Sequence (398 amino acids)

>AMB_RS08200 aminoacetone oxidase family FAD-binding enzyme (Magnetospirillum magneticum AMB-1)
MRAIVIGAGPAGLMAAEVMASHGLKVEIFDAMASPGRKFLLAGKGGLNLTHSEPPERFVT
RYGTAAGFMAPLLAQFGADPLRAWAEGLGVSTFVGSSGRVFPAEMKAAPLLRAWMRRLRG
LGVVLHTRRRWLGWDDHNHLRFAGPEGEETVDAKVCVLALGGASWPNLGSDGGWAPILAA
KGIAITPLKPANCGFDLDWSPSFAERFAGGRTGTVELTFKGQKRRGEVTVTATGIEGGAV
YALSAELRDALAEEGQAELLVDLMPDWSPAKVAAALGRPRGSRSLSTFLKKALPLNPMAL
GLLREACSASEPGALAKAIKALPLRLKRPRPLAEAISTAGGIGLAELDDGMMLKALPGVW
VAGEMLDWEAPTGGYLLTGCFATGVAAGLGVLQRCNSL