Protein Info for AMB_RS08175 in Magnetospirillum magneticum AMB-1

Annotation: peptide chain release factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR00019: peptide chain release factor 1" amino acids 5 to 353 (349 residues), 497.4 bits, see alignment E=1e-153 PF03462: PCRF" amino acids 13 to 200 (188 residues), 237 bits, see alignment E=1.7e-74 PF00472: RF-1" amino acids 207 to 317 (111 residues), 145 bits, see alignment E=9.1e-47

Best Hits

Swiss-Prot: 100% identical to RF1_MAGSA: Peptide chain release factor 1 (prfA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02835, peptide chain release factor 1 (inferred from 100% identity to mag:amb1618)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6V3 at UniProt or InterPro

Protein Sequence (354 amino acids)

>AMB_RS08175 peptide chain release factor 1 (Magnetospirillum magneticum AMB-1)
MNLETQFDKVLYRHDEVRAQLSSGEGMDSQTIQRLSKELSELDPVVTAVQAFRKAREDMV
QAAEMMNDPDMKDLAEEEFYALKERLPALEREVQIMLLPKDEADEKNAIIEVRAGTGGEE
AALFAAELFRMYERYAGLHGWRFEVMDVNDTGIGGVKEASATITGRNVFARLKFESGVHR
VQRVPATESQGRIHTSAATVAIMPEAEEVDIQLNDSDLRFDVYRSQGSGGQSVNTTDSAV
RVTHIPTGLAVACQQEKSQHKNKATALKLLRARLYERERSAKDAERAAARKSQVGSGDRS
ERIRTYNFPQGRVTDHRINMTLYKIDAVMSGDALDELVEALVAADQAERLAEME