Protein Info for AMB_RS08140 in Magnetospirillum magneticum AMB-1

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 3 to 229 (227 residues), 161.2 bits, E=7.4e-51
• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 3 to 402 (400 residues), 436.1 bits, E=1.4e-134
• TIGR00657: aspartate kinase
  • amino acids 63 to 401 (339 residues), 384.7 bits, E=6.9e-119
• PF01842: ACT
  • amino acids 265 to 325 (61 residues), 50.3 bits, E=3.2e-17
• PF22468: ACT_9
  • amino acids 269 to 325 (57 residues), 41.5 bits, 1.9e-14
  • amino acids 343 to 400 (58 residues), 82.6 bits, E=2.7e-27
• PF13840: ACT_7
  • amino acids 337 to 398 (62 residues), 59.2 bits, E=5.7e-20

Best Hits

Swiss-Prot: 58% identical to AK_PSEAE: Aspartokinase (lysC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to mag:amb1612)

MetaCyc: 46% identical to aspartokinase (Streptomyces platensis)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

See Q2W6V9 at UniProt or InterPro

Protein Sequence (406 amino acids)

>AMB_RS08140 aspartate kinase (Magnetospirillum magneticum AMB-1)
MARIVMKFGGTSVADIERIKNVANRVKREFDAGNQVAVVVSAMSGATNQLVAWCNQVAPL
HDAREYDAVVATGEQVTTGLLAIALQELGVNARSWCGWQLPIRTDGVHGKARIMSIETDE
MIARMGKGEVAVVAGFQGLGPDNRIATLGRGGSDTSAVALAAALHADRCDIYTDVDGVYT
TDPRIVSVAKKLDKITYEEMLELASVGAKVLQTRSVEMAMKHRVRVQVLSSFEDKPGTLV
CDEDEIVEKELVSGIAYSRDEAKITLVRVADRPGVAASIFGPLAEAAVNVDMIVQNVSED
GKSTDLTFTVGNADLERAKKVLEDAKGNLGFEKLLADPNVVKVSVIGVGMRSHAGIAQKM
FQTLASEGINIQVISTSEIKISVLIEEKYTELALRALHTAYGLDAA