Protein Info for AMB_RS08135 in Magnetospirillum magneticum AMB-1

Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 11 to 238 (228 residues), 278.1 bits, E=2.2e-87
• PF13489: Methyltransf_23
  • amino acids 60 to 214 (155 residues), 74.7 bits, E=2.1e-24
• PF02353: CMAS
  • amino acids 62 to 172 (111 residues), 33 bits, E=1.3e-11
• PF13847: Methyltransf_31
  • amino acids 62 to 195 (134 residues), 51.9 bits, E=2.2e-17
• PF13649: Methyltransf_25
  • amino acids 67 to 157 (91 residues), 57.8 bits, E=4.5e-19
• PF08242: Methyltransf_12
  • amino acids 67 to 159 (93 residues), 52.7 bits, E=1.7e-17
• PF08241: Methyltransf_11
  • amino acids 67 to 160 (94 residues), 68.4 bits, E=2.1e-22

Best Hits

Swiss-Prot: 100% identical to UBIG_MAGSA: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to mag:amb1611)

MetaCyc: 52% identical to 2-polyprenyl-6-hydroxyphenol methylase (Cereibacter sphaeroides)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; RXN-9233 [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (8/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (5/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (5/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (4/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (3/9 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

See Q2W6W0 at UniProt or InterPro

Protein Sequence (244 amino acids)

>AMB_RS08135 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Magnetospirillum magneticum AMB-1)
MDHVGTASPEEIARFTAMAEAWWDPQGKFKPLHRFNPVRLAFMRRHFAAHFGRDESLMRP
FEGLTLLDVGSGGGLLSEPLARMGFAVTGIDAGDKNVAVARLHAEQTGVPVDYRVSTPEQ
LDPNEAFDVVLSMEVVEHVPDVSAFLGHATARLKPGGVFMGATLNRTAKAWALAVVGAEY
VLGWLPKGTHDWNKFVRPSEFAAMLRDRGITVRQMAGMAFNPLSDTWRETDNLDVNYMLF
GVKG