Protein Info for AMB_RS08135 in Magnetospirillum magneticum AMB-1

Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 11 to 238 (228 residues), 278.1 bits, see alignment E=2.2e-87 PF13489: Methyltransf_23" amino acids 60 to 214 (155 residues), 75.8 bits, see alignment E=1.2e-24 PF02353: CMAS" amino acids 62 to 172 (111 residues), 33 bits, see alignment E=1.5e-11 PF13847: Methyltransf_31" amino acids 62 to 194 (133 residues), 51.2 bits, see alignment E=3.9e-17 PF08242: Methyltransf_12" amino acids 67 to 159 (93 residues), 53 bits, see alignment E=1.7e-17 PF08241: Methyltransf_11" amino acids 67 to 160 (94 residues), 68.4 bits, see alignment E=2.5e-22 PF13649: Methyltransf_25" amino acids 67 to 157 (91 residues), 58 bits, see alignment E=4.4e-19

Best Hits

Swiss-Prot: 100% identical to UBIG_MAGSA: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to mag:amb1611)

MetaCyc: 52% identical to 2-polyprenyl-6-hydroxyphenol methylase (Cereibacter sphaeroides)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; RXN-9233 [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6W0 at UniProt or InterPro

Protein Sequence (244 amino acids)

>AMB_RS08135 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Magnetospirillum magneticum AMB-1)
MDHVGTASPEEIARFTAMAEAWWDPQGKFKPLHRFNPVRLAFMRRHFAAHFGRDESLMRP
FEGLTLLDVGSGGGLLSEPLARMGFAVTGIDAGDKNVAVARLHAEQTGVPVDYRVSTPEQ
LDPNEAFDVVLSMEVVEHVPDVSAFLGHATARLKPGGVFMGATLNRTAKAWALAVVGAEY
VLGWLPKGTHDWNKFVRPSEFAAMLRDRGITVRQMAGMAFNPLSDTWRETDNLDVNYMLF
GVKG