Protein Info for AMB_RS07890 in Magnetospirillum magneticum AMB-1

Annotation: ferredoxin III, nif-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 TIGR02936: ferredoxin III, nif-specific" amino acids 6 to 96 (91 residues), 136 bits, see alignment E=1.9e-44 PF13237: Fer4_10" amino acids 21 to 87 (67 residues), 32.6 bits, see alignment E=3.4e-11 PF00037: Fer4" amino acids 21 to 37 (17 residues), 24.9 bits, see alignment 7.4e-09 amino acids 73 to 91 (19 residues), 22.6 bits, see alignment 3.9e-08 PF12837: Fer4_6" amino acids 22 to 41 (20 residues), 26.6 bits, see alignment 2.4e-09 PF12800: Fer4_4" amino acids 25 to 38 (14 residues), 17.7 bits, see alignment (E = 2e-06) amino acids 76 to 89 (14 residues), 14.5 bits, see alignment (E = 2.2e-05) PF13484: Fer4_16" amino acids 27 to 88 (62 residues), 36.6 bits, see alignment E=3.4e-12 PF12838: Fer4_7" amino acids 27 to 91 (65 residues), 40 bits, see alignment E=2.4e-13 PF13187: Fer4_9" amino acids 27 to 90 (64 residues), 30.5 bits, see alignment E=1.7e-10

Best Hits

Swiss-Prot: 53% identical to FER3_SINFN: Putative ferredoxin-3 (fdxB) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to mag:amb1565)

Predicted SEED Role

"4Fe-4S ferredoxin, nitrogenase-associated" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W706 at UniProt or InterPro

Protein Sequence (99 amino acids)

>AMB_RS07890 ferredoxin III, nif-specific (Magnetospirillum magneticum AMB-1)
MSFRQFTTRDGSVWIPKYLTKISAELCIGCGRCFKVCTHSVMKLMGFSEEGEYIDPEEDD
DGEIEKTVMAIANEGNCIGCGACFAVCGTKAQTHEPVPA