Protein Info for AMB_RS07865 in Magnetospirillum magneticum AMB-1

Annotation: ATP-dependent chaperone ClpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 863 PF02861: Clp_N" amino acids 5 to 130 (126 residues), 111.7 bits, see alignment E=1.5e-35 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 6 to 853 (848 residues), 1385.5 bits, see alignment E=0 PF00004: AAA" amino acids 205 to 322 (118 residues), 42.5 bits, see alignment E=4.9e-14 amino acids 601 to 718 (118 residues), 31.9 bits, see alignment E=9.3e-11 PF17871: AAA_lid_9" amino acids 345 to 445 (101 residues), 120.2 bits, see alignment E=1.9e-38 PF07724: AAA_2" amino acids 595 to 759 (165 residues), 237 bits, see alignment E=6.6e-74 PF00158: Sigma54_activat" amino acids 598 to 716 (119 residues), 21 bits, see alignment E=1.3e-07 PF07728: AAA_5" amino acids 600 to 719 (120 residues), 50 bits, see alignment E=1.8e-16 PF10431: ClpB_D2-small" amino acids 765 to 845 (81 residues), 96.2 bits, see alignment E=5.4e-31

Best Hits

Swiss-Prot: 73% identical to CLPB_RHOPA: Chaperone protein ClpB (clpB) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 76% identity to azl:AZL_001460)

MetaCyc: 59% identical to protein disaggregase ClpB (Escherichia coli K-12 substr. MG1655)
RXN185E-10

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W711 at UniProt or InterPro

Protein Sequence (863 amino acids)

>AMB_RS07865 ATP-dependent chaperone ClpB (Magnetospirillum magneticum AMB-1)
MDFEKFTERCKGFIQSAQTLALRSGHQRLTPEHLAQVLLADKEGLAANLIRAAGGDPVRA
LKGVETELGKLPKVEGPGAGGVHLAPELARLLDQAVQLADKAGDSFVTAERLLLALTLAT
GTSTAKVLAEAGVTPQGLNHAIEDVRKGRKANSASAEDSYDALKKYARDLTQAARDGKLD
PVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAIRIINGDVPETLKNKRLM
VLDLGALVAGAKFRGEFEERLKAVLTEVTAANGEVVLFIDEMHTLIGAGAAEGSMDASNL
LKPALARGELHCIGATTLNEYRKHVEKDAALARRFQPVFVSEPGVEDTVSILRGLKEKYE
LHHGVRIADGALVSAATLSNRYITDRFLPDKAIDLVDEAASRLRMQIDSKPEALDELDRR
IVQLKIEREALRKESDAGSRDRLGKLEVELNQLERESFDMSERWRAEKSQLADSTKVKEQ
LEEARIELANAERASNWARAGELKFGVIPDLEKRIEGGGDSGSRMLTESVTEEHIASVVS
RWTGIPVEKMLQGERDKLLGMESRLKTRVVGQSEALVAVSNAVRRARAGLQDPNRPIGSF
LFLGPTGVGKTELTKALAEFMFDDETAMVRMDMSEYMEKHSVARLIGAPPGYVGYEEGGA
LTEAVRRRPYQVILFDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTLIVLTSNLG
SEILANQEEGHDSAEVRAEVMEVVRASFRPEFLNRLDEILLFHRLGRGDMSGIVDIQLKR
LRALLADRKITLSLDAGAMEWLAEKGYDPAYGARPLKRVIQRALQNPLAGLILEGVVKDG
DAVTVAAGEGGLLMNGRFTGGEV