Protein Info for AMB_RS07815 in Magnetospirillum magneticum AMB-1

Annotation: cation acetate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 306 to 332 (27 residues), see Phobius details amino acids 366 to 394 (29 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 441 to 465 (25 residues), see Phobius details amino acids 473 to 496 (24 residues), see Phobius details amino acids 508 to 528 (21 residues), see Phobius details PF00474: SSF" amino acids 71 to 480 (410 residues), 383.6 bits, see alignment E=5.7e-119 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 71 to 480 (410 residues), 198.9 bits, see alignment E=7.4e-63

Best Hits

Swiss-Prot: 67% identical to ACTP_SALG2: Cation/acetate symporter ActP (actP) from Salmonella gallinarum (strain 287/91 / NCTC 13346)

KEGG orthology group: K14393, cation/acetate symporter (inferred from 100% identity to mag:amb1546)

MetaCyc: 66% identical to acetate/glycolate:cation symporter (Escherichia coli K-12 substr. MG1655)
RXN0-1981; RXN0-5111; TRANS-RXN0-576

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W725 at UniProt or InterPro

Protein Sequence (561 amino acids)

>AMB_RS07815 cation acetate symporter (Magnetospirillum magneticum AMB-1)
MKTTKTAIASALAFGGTALLASAALAAGADMGGAEKQATNWHAIIMFVIFVGATLGITYW
AAGRTKTAADFYAAGGGITGFQNGLAIAGDYMSAASFLGISALVYGSGYDGLIFSVGWLV
GWPIILFLIAERLRNLGKYTFADVCGYRLARTPIRTFAATGSLIVVIFYLIGQMVGAGQL
IKLLFGMDYVYAVMIVGALMMVYVTFGGMVATTWVQIIKACLLLGGATFIAFGVMSQFGF
SFEKLFVKAIEVHPKKVAIMAPGALVTNPVDAISLGMALMFGTAGLPHILMRFFTVPDAR
EARKSVFYATGFIGYFYILTFIIGFGAITMVATNPEYLTKGLGSLDLKGGNNMAAVWLAH
AIGGNLFLGFISAVAFATILAVVSGLTLAGASAISHDLYASVIMHGQATEGKEVTVSKIA
SICLGVIAVLLGLVFEKQNVAFIVALTFSVAASANFPVLVLSMFWGGLTTRGAVLGGMIG
LLMSVIMVVLSKAVWVQSFGFKAEIFPFAYPALFSVPAAFFFSWLFSIMDNSPSAQAERA
AYEAQSIRSETGLGAEGAASH