Protein Info for AMB_RS07800 in Magnetospirillum magneticum AMB-1

Annotation: CBS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF00571: CBS" amino acids 20 to 73 (54 residues), 41.3 bits, see alignment 2.3e-14 amino acids 89 to 138 (50 residues), 40.2 bits, see alignment 5.4e-14 PF03445: DUF294" amino acids 165 to 300 (136 residues), 124.6 bits, see alignment E=4.2e-40 PF10335: DUF294_C" amino acids 342 to 472 (131 residues), 97.8 bits, see alignment E=8e-32

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 100% identity to mag:amb1544)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W727 at UniProt or InterPro

Protein Sequence (479 amino acids)

>AMB_RS07800 CBS domain-containing protein (Magnetospirillum magneticum AMB-1)
MNDIAALARIDSFPYRHRLREVMSAPVLTALASVTLHDAVHRMYEARVSSIVGIDAEGRT
LGIFTERDLLRILSTNGPAGLEQTLDQTMTKPVATVSAEAYVYVALARMTRLGLRHLVVV
DEDNRPLGMITGRALLKVRATEALVLGDSAESASNPDEMKAVMTNLPKLAKSLLGEGVTA
RNIASVIALVLRDLTARASELAEQSLLDDGWGPAPARYAVLILGSGGRGESLLAFDQDNA
IVHDGKPADDPWFAELGKRLNETLNKAGIPFCDGNVMARESKWRKSLEEWRDEVHGWVFS
VENQTVMYCDIFFDFQPVWGDRALAEELRHMAMEKAAQSAFFLRYLAQNVAGMDGSIGLF
GNFVTKQGRLNAKKFGLLPLVSAARMRAIRAHIQVTGTDERFAALKESGVLHEDDLRDFV
EVREIVLRVMLEQQLADIAQQIPASAKIDPKRFDKRTRNRLKWAFRRIKTLKFVCGVGG