Protein Info for AMB_RS07745 in Magnetospirillum magneticum AMB-1

Annotation: disulfide bond formation protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 56 (18 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details PF02600: DsbB" amino acids 6 to 151 (146 residues), 110.6 bits, see alignment E=4.7e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1533)

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W738 at UniProt or InterPro

Protein Sequence (159 amino acids)

>AMB_RS07745 disulfide bond formation protein B (Magnetospirillum magneticum AMB-1)
MNTALRPIALSVAGICLAALAFALVAQYGFGLRPCNLCLIQRVPFVLAALLAAAALRDGA
PAALLLRIAGLLLLINGGIAVYHVGVEQHWWASAVCSGNQGGEIAVADLLAEMNKPAEAQ
CDTPAWSFHGITMAALNVPFSALFGLAVLWAARRSEGSA