Protein Info for AMB_RS07740 in Magnetospirillum magneticum AMB-1

Annotation: demethoxyubiquinone hydroxylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03232: COQ7
  • amino acids 19 to 182 (164 residues), 225.7 bits, E=2.8e-71
• PF02915: Rubrerythrin
  • amino acids 22 to 151 (130 residues), 38.9 bits, E=1.1e-13

Best Hits

Swiss-Prot: 54% identical to COQ7_RAT: 5-demethoxyubiquinone hydroxylase, mitochondrial (Fragment) (Coq7) from Rattus norvegicus

KEGG orthology group: K06134, ubiquinone biosynthesis monooxygenase Coq7 [EC: 1.14.13.-] (inferred from 100% identity to mag:amb1532)

MetaCyc: 43% identical to 5-demethoxyubiquinol hydroxylase (Caenorhabditis elegans)
RXN-9243 [EC: 1.14.99.60]

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (8/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (5/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (5/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (4/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (3/9 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.99.60

Sequence Analysis Tools

See Q2W739 at UniProt or InterPro

Protein Sequence (185 amino acids)

>AMB_RS07740 demethoxyubiquinone hydroxylase family protein (Magnetospirillum magneticum AMB-1)
MRKTGDDAIPGDLDHAGLIDRFLRVNQAGELGAVRIYQGQRAILGRKGGPTAPLLKRMAE
QEQEHLDTFSHLIGERRTRPTVLSPLWHLAGFALGAGTALLGEKAAMACTVAVEETIDEH
YARQAEQLGEDEAALKDTIRKFREDEIEHRDIGLAHGAEQAPAYPLLSSAIKGGCRLAIW
LSERI