Protein Info for AMB_RS07495 in Magnetospirillum magneticum AMB-1

Annotation: xanthine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00941: FAD_binding_5
  • amino acids 5 to 166 (162 residues), 144.4 bits, E=3.1e-46
• PF03450: CO_deh_flav_C
  • amino acids 177 to 276 (100 residues), 53 bits, E=3.3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1484)

Predicted SEED Role

"Xanthine dehydrogenase, FAD binding subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

• inosine 5'-phosphate degradation (3/4 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• guanosine nucleotides degradation II (2/4 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• purine nucleotides degradation II (aerobic) (6/11 steps found)
• ureide biosynthesis (3/7 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• superpathway of guanosine nucleotides degradation (plants) (2/6 steps found)
• purine nucleotides degradation I (plants) (6/12 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)
• superpathway of purines degradation in plants (6/18 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

See Q2W787 at UniProt or InterPro

Protein Sequence (280 amino acids)

>AMB_RS07495 xanthine dehydrogenase (Magnetospirillum magneticum AMB-1)
MRCDYPTTVNEALALLAAAPDSVLVAGCTDFFPAQGLAPITRPIIDLSAIAEARGIAAGA
DGWRFGALTTWSDIATADLPARFRGLQQAARQVGALQIQNVGTIGGNLCNASPAADGVPP
LLCLDASVELASAEGTRKVPLDRFILGNRKTERRPDEMVTAILIPDGGAKAASAFLKLGS
RTSLVISIAMVSVLLEADGAGKVARAAVAVGACSVVAKRLEALEADLRGQPVSPGLADLV
TPAHLSPLSPIRDLRGTPEYRLDVALTMIRRGLAEVGGLV