Protein Info for AMB_RS07465 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 29 to 369 (341 residues), 243.2 bits, see alignment E=9.9e-76 PF13433: Peripla_BP_5" amino acids 47 to 378 (332 residues), 101.3 bits, see alignment E=9.7e-33 PF01094: ANF_receptor" amino acids 53 to 328 (276 residues), 52.7 bits, see alignment E=5.5e-18

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to mag:amb1478)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W793 at UniProt or InterPro

Protein Sequence (402 amino acids)

>AMB_RS07465 ABC transporter substrate-binding protein (Magnetospirillum magneticum AMB-1)
MDRRTVLKSFALAALMAGSQMGTASAADTIKIGEINSYTSLPAFTLPYRSGWQLALDEIN
AAGGINGKKLEVISRDDGGKPGDAVTAANELVSRENVSVLFGTFFSHIGLAVSDFANQRK
IVFVAAEPLTDALTMEKGNRYTFRLRPGTYMQAAMLVDQAAKLPAKTWATVAPNYEYGQV
AVKVFKELMSAKRPDIKWVDEQWPAMGKIDGGATVQALARAEPEAIFNVTFGADLTKFIR
EGNTRGLFKNRSVVSLLTGEPEYLDPLGDETPSGWIVSGYPWEQIKTPEHEAFLKAYKAK
FNDYPRLGSVVGYNTMKAVAEMIRKAGSVDTDKLIAAGEGLKIDSPLGPITFRAEDHQST
MGGYIGKTAMKDGKGMMVDWHYANGADYLPALAEVAKARPKN