Protein Info for AMB_RS07325 in Magnetospirillum magneticum AMB-1

Annotation: succinoglycan biosynthesis transport protein exoP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 736 transmembrane" amino acids 37 to 62 (26 residues), see Phobius details amino acids 453 to 473 (21 residues), see Phobius details PF02706: Wzz" amino acids 22 to 112 (91 residues), 34 bits, see alignment E=7.3e-12 PF13807: GNVR" amino acids 401 to 472 (72 residues), 39.4 bits, see alignment E=1.2e-13 PF13614: AAA_31" amino acids 539 to 675 (137 residues), 46 bits, see alignment E=1.5e-15 PF01656: CbiA" amino acids 542 to 681 (140 residues), 26 bits, see alignment E=2e-09 PF09140: MipZ" amino acids 543 to 657 (115 residues), 22.2 bits, see alignment E=2e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1450)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7C1 at UniProt or InterPro

Protein Sequence (736 amino acids)

>AMB_RS07325 succinoglycan biosynthesis transport protein exoP (Magnetospirillum magneticum AMB-1)
MNEIYPVRPISNASATRTDGFNIDLRQQIRVLWRRRFLVFAVAGGVFIATWLFLMLLTPI
YAGMASVMIDTRKTRVLDLKEVITTSQPQLTTVLSEVEVIRSRNVAERVAASLDLYKDPE
FNPSLRPAKSGVAAALNSLMSWLSAPKQQDLGPEEAERAMRAGVVTTLVGRVTAVPVPQS
MVINVSVRSEDAAKAAQLTNALAEQYVLDQLNSKFEATRSASVWLNQRLEDLRNAVAQSE
RAVAQYRGSSGLIDSKGVLPTHQQLAELNTQLIQTQGRRSELQAKVARLETLIRSNRGAE
AADEMIESPLIQRLREQETTLMREISDMSTRYGDMHPKMIKGVAELNELRAKINVEISKL
SQGIHNEYNVVRARESALLDRIRQLEGTVKEQNRSEVHLRELEREAQANRILYENFLSRF
KETSEQEQVQQPDARIISRAVRPYSPAFPRKGLIQLAMTVVGLLLGTILALVLERLDNTF
RTREELEDVTGLPAIGMIPFVDKKPVAKYLIDRPTSAFAEALRGLWISLCHSDPNSSPRV
VAITSSFPGEGKSMTALSLARTVALLGSRVVLVDCDLRRSSVAKLLEIQPEHCLDDVLGG
KVELRAAVLRDQSSDLDILPARNMDRAPLDMLNSAVMENLLHTLRGIYDLVILDCPPVIP
VAEAQVLGRLADKTVFCVLWDQTPREAVVNALRQLRDVQVSLAGAMLTKVHLKKHARYGY
GDIGYYYGRYKGYYAD