Protein Info for AMB_RS07300 in Magnetospirillum magneticum AMB-1

Annotation: sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 53 to 485 (433 residues), 330.5 bits, see alignment E=1.1e-102 PF02397: Bac_transf" amino acids 287 to 480 (194 residues), 196.5 bits, see alignment E=1.4e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1446)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7C5 at UniProt or InterPro

Protein Sequence (486 amino acids)

>AMB_RS07300 sugar transferase (Magnetospirillum magneticum AMB-1)
MCHYDVYCCLQCCEQGWLTGSMRLVMRESELRASGADRVGMAGRAVVPLLIAADVLTLEL
FVLLGMWLREAVSVWFPISLAPVTFHGIHLAVLVIPLGCLVWGLYPGYGLSPVDRLRRRT
LVVLVGFGLMDVYDHLGQNGQWSRGVLVVAMALAVVGLPITHAWARRTLLRLGLWGEKVV
LLGDPERCRMTAAALSARPDLGWIPAGIGNWPLDGEGHWNDAEMAILLPLRGELSLAEAA
DSLPFRRMVVIPDLGGRSLGVSSLETGLGLGLGMRNNLLYPVNRMLKRSLDLVAVLLALP
LALPVIAAFALAVKVISPGPAFYGQQREGLGGRPFRLWKIRSMTPDAETRLDEVLGQDAR
TQGEWKSRMKLEDDPRIIPGIGRFMRRFSIDELPQLLNVLLGHMSLVGPRPLPAYHLAEI
SPALVALRQQVRPGITGWAQISGRSHSTVLQQVEYDAYYIRNWSFWIDSYVLARTVEVVL
SARGAF