Protein Info for AMB_RS07285 in Magnetospirillum magneticum AMB-1

Annotation: Lipid A core - O-antigen ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 47 (18 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 128 to 129 (2 residues), see Phobius details amino acids 135 to 161 (27 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 323 to 339 (17 residues), see Phobius details PF04932: Wzy_C" amino acids 134 to 280 (147 residues), 33 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1443)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7C8 at UniProt or InterPro

Protein Sequence (354 amino acids)

>AMB_RS07285 Lipid A core - O-antigen ligase (Magnetospirillum magneticum AMB-1)
MLWVLLTTYLGLAFLHGALSYGLQTAVASYRASLYLTVGVSYFALFQHDRNDTIWTLNLV
ILAGLAVVLFAIAAWLVPEWRPQDPGHMALSSQAYERSRVLPAQAAQFIALAALLSLPSW
LQVGSSLWLRLATLPLLAVSIFLFHRSVWVMLAVSVLVTLAASGRGAVRAFVVVQFLLVA
LALVWLLLVGLDMDILSASLRTAVNEAVDLDNNTLDWRIQGWRILVERAISDGPLSILFG
AGFGIGYERNIAQLYVTASPHNYYVELFLTSGLLGCGLFVLSILSVFRRALSQALHGGAN
EMLALPGMVIGVVVYSASYSPQYDTALILGLILALPAIPRRRPIPEGVSQPAPP